PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT01449
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 592aa    MW: 64757.8 Da    PI: 7.7193
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT01449genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.69.5e-32375430359
               -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               DgynWrKYGqK+vkgsefprsYY+Ct+++Cpvk+kve++  d+++ ei+Y+geHnh+
  EMT01449 375 DGYNWRKYGQKQVKGSEFPRSYYKCTHPTCPVKRKVETTV-DGQIAEIVYNGEHNHP 430
               9***************************************.***************8 PP

2WRKY84.69.3e-27536589459
               SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   4 gynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ++WrKYGqK v+g+ fprsYYrC++a+C+++k vers+ d + +++tYeg+Hnh 
  EMT01449 536 AFRWRKYGQKAVNGNSFPRSYYRCSTARCNARKFVERSS-D-NSLVTTYEGKHNHV 589
               69*************************************.4.567799*******6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS506009.7831173IPR003653Ulp1 protease family, C-terminal catalytic domain
SuperFamilySSF540011.47E-3118218No hitNo description
Gene3DG3DSA:3.30.310.1301.6E-569167No hitNo description
PfamPF029029.9E-676171IPR003653Ulp1 protease family, C-terminal catalytic domain
PROSITE profilePS5081122.871368432IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.8E-27368432IPR003657WRKY domain
SuperFamilySSF1182901.83E-24369432IPR003657WRKY domain
SMARTSM007741.2E-34373431IPR003657WRKY domain
PfamPF031063.9E-24375430IPR003657WRKY domain
SMARTSM007749.4E-27533590IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-23534589IPR003657WRKY domain
PROSITE profilePS5081122.768534588IPR003657WRKY domain
SuperFamilySSF1182902.22E-20535588IPR003657WRKY domain
PfamPF031069.9E-22536588IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006508Biological Processproteolysis
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008234Molecular Functioncysteine-type peptidase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 592 aa     Download sequence    Send to blast
MRPAGAASAS TAGEDGNERV LSYGDVVLLR SDLSILRGDD DGDLLLLPPS IPYLLSNLPD  60
PDSVAAVAEP LRLASRSLVL LPVNDNPDAS VAEGGSHWTL LVLDATNGAS RPRFVHHDSL  120
GVLNSDAARQ LAAVLRPLLP GAANGAPLVE GPTPMQANGH DCGVYVIALA RAICNWWRDR  180
RGQQQEGGAD WFDTVRKEVD AESVKAMRAE LLHLIARLIQ DKEDEKKNKA VVVFPYRQEY  240
MFQIYDTLQS ETCRHKWKMQ SQEKITPVKP VASRPFSSFT SFSKLLKDFT ATGSAKITSP  300
GETVIVRRPK ATRFAPPPSD LSAGVAASML QDAGLDTTRE KMVIDPEQVV SCDQMTAFHD  360
INKPIHSVKN RLSYDGYNWR KYGQKQVKGS EFPRSYYKCT HPTCPVKRKV ETTVDGQIAE  420
IVYNGEHNHP QPHPPKKPVS SASTEVVVPD AHGNNDAGAE SQLGECNLAL VSDPVAAAFK  480
SSCDYVDEFG NTGPVYHCNT SPKEKQSSIA NGLPSSGEAA PAFQPPTECR SSGDAAFRWR  540
KYGQKAVNGN SFPRSYYRCS TARCNARKFV ERSSDNSLVT TYEGKHNHVQ LR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2bkr_A1e-18201805182SENTRIN-SPECIFIC PROTEASE 8
2bkq_D1e-18201805182SENTRIN-SPECIFIC PROTEASE 8
2bkq_C1e-18201805182SENTRIN-SPECIFIC PROTEASE 8
2bkq_B1e-18201805182SENTRIN-SPECIFIC PROTEASE 8
2bkq_A1e-18201805182SENTRIN-SPECIFIC PROTEASE 8
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3689820.0AK368982.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2083E14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229417.11e-168PREDICTED: WRKY transcription factor 44-like
RefseqXP_015698188.11e-167PREDICTED: uncharacterized protein LOC102718700
TrEMBLN1QRF50.0N1QRF5_AEGTA; Uncharacterized protein
STRINGMLOC_10687.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23252941
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-48WRKY DNA-binding protein 3